PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA002178-PA
Common NameOsI_00797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 139aa    MW: 15190.3 Da    PI: 8.9931
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA002178-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.85.2e-3287136150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  BGIOSGA002178-PA  87 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 136
                       79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-4279138IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.99279139IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-2980138IPR002100Transcription factor, MADS-box
CDDcd002653.98E-4080138No hitNo description
PROSITE patternPS00350081135IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-3381101IPR002100Transcription factor, MADS-box
PfamPF003193.2E-2788135IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-33101116IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-33116137IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MRESPPNFDS LPVQTKQVSD LQQQEAKLCK QSYIRVTCIT YSETDLSCGP SSMTELTAAA  60
APAGSGSSAA VAAGSSEKMG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE  120
VALIVFSSRG RLYEYANNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-2279136158Myocyte-specific enhancer factor 2B
1tqe_Q8e-2279136158Myocyte-specific enhancer factor 2B
1tqe_R8e-2279136158Myocyte-specific enhancer factor 2B
1tqe_S8e-2279136158Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.3207e-52flower| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0031051e-160AP003105.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0489A05.
GenBankAP0031971e-160AP003197.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1015E06.
GenBankAP0149571e-160AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126091e-160CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632490.18e-63PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_015632498.18e-63PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotP293853e-39AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLA2WLS91e-99A2WLS9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002178-PA4e-99(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.28e-39MIKC_MADS family protein